FGF-11 isoform 2 (Fibroblast growth factor-11 isoform 2), Human
Sequence:
MSLSPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSP
HFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSV
PEASPSSPPAP with polyhistidine tag at the C-terminus
Source:
Escherichia coli
Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography
Endotoxin Test:
<0.1 EU/μg by LAL method
Bioactivity (ED50):
0.553 ng/mL measured by its ability to induce 3T3 cells proliferation.
Suggested application:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
SDS-PAGE analysis of recombinant human FGF-11 isoform 2
%2C%20Human.jpg)
Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. The protein was lyophilized from a solution containing 1XPBS, pH 7.4. Please use finished within one month after protein reconstitution.
MSLSPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSP
HFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSV
PEASPSSPPAP with polyhistidine tag at the C-terminus
Source:
Escherichia coli
Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography
Endotoxin Test:
<0.1 EU/μg by LAL method
Bioactivity (ED50):
0.553 ng/mL measured by its ability to induce 3T3 cells proliferation.
Suggested application:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
SDS-PAGE analysis of recombinant human FGF-11 isoform 2
%2C%20Human.jpg)
Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. The protein was lyophilized from a solution containing 1XPBS, pH 7.4. Please use finished within one month after protein reconstitution.
Reviews for FGF-11 isoform 2 (Fibroblast growth factor-11 isoform 2), Human
Average Rating: 0 (0 Reviews )