Products

FGF-21 (Fibroblast growth factor-21), Human

No. Size Price Qty Status
RA-FH901 50 ug $283.06
RA-FH902 100ug $510.65
The price does not include shipping fee and tax. Order Request Quote
Sequence:
MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQR
PDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQ
PPDVGSSDPLSMVGPSQGRSPSYAS with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Endotoxin Test:
<0.1 EU/μg by LAL method

Suggested application:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

SDS-PAGE analysis of recombinant human FGF-21



Storage: 

Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. The protein was lyophilized from a solution containing 1XPBS, pH 8.0. Please use finished within one month after protein reconstitution.

 
Reviews for FGF-21 (Fibroblast growth factor-21), Human

Average Rating: 0 (0 Reviews )