EGF (Epidermal growth factor) , Human
Sequence:
MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYR DLKWWELRLE
with polyhistidine tag at the C-terminus
Source: Escherichia coli
Purity:
>95% as determined by SDS-PAGE. Ni-NTA chromatography
Endotoxin Test:
<0.1 EU/μg by LAL method
Bioactivity (ED50):
0.0483-0.12 ng/mL Measure by its ability to induce 3T3 cells proliferation.
Suggested application:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
SDS-PAGE analysis of recombinant human EGF
%20%2C%20Human.jpg)
Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. The protein was lyophilized from a solution containing 1XPBS, pH 8.0. Please use finished within one month after protein reconstitution.
MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYR DLKWWELRLE
with polyhistidine tag at the C-terminus
Source: Escherichia coli
Purity:
>95% as determined by SDS-PAGE. Ni-NTA chromatography
Endotoxin Test:
<0.1 EU/μg by LAL method
Bioactivity (ED50):
0.0483-0.12 ng/mL Measure by its ability to induce 3T3 cells proliferation.
Suggested application:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
SDS-PAGE analysis of recombinant human EGF
Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. The protein was lyophilized from a solution containing 1XPBS, pH 8.0. Please use finished within one month after protein reconstitution.
