Products

CXCL12 (24-88) (C-X-C motif chemokine 12), Human

No. Size Price Qty Status
RA-FE701 20ug $183.49 Out of stock
RA-FE702 100ug $780.91 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence:
MVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN with
polyhistidine tag at the C-terminus

Source:
Escherichia coli

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Endotoxin Test:
<0.1 EU/μg by LAL method

Suggested application:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

SDS-PAGE analysis of recombinant human CXCL12 (24-88)



Storage: 

Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.1 M NaCl, pH 4.5. Please use finished within one month after protein reconstitution.
Reviews for CXCL12 (24-88) (C-X-C motif chemokine 12), Human

Average Rating: 0 (0 Reviews )